£0.00
Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
AD Drums Purple & White Pearl Pinstripe Snare Drum
AD Drums Purple & White Pearl Pinstripe Snare Drum
£399.00
£230.00 inc. tax
AD Drums
Shell: 6mm Birch Sizes: 14x6.5 Finish: Purple & black pearl wrap Spec: 2.3mm hoops Chrome hardware Deluxe Strainer
Product code ADSNR10
Product condition: New
weight: 2700.0g
Add to Cart
Updating Order Details
Please do not refresh or navigate away from the page!

Customer Reviews

No Reviews Posted Yet - be the first!

write review

Featured Products

AD Drums Wood / Acrylic Hybrid Snare Drum
AD Drums Wood / Acrylic Hybrid Snare Drum
AD Drums £299.00
Add To Cart
AD Drums Green Stain with Gloss Lacquer Snare Drum
AD Drums Green Stain with Gloss Lacquer Snare Drum
AD Drums £299.00
Add To Cart
AD Drums Purple & White Pearl Pinstripe Snare Drum
AD Drums Purple & White Pearl Pinstripe Snare Drum
AD Drums £230.00
Add To Cart
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i